Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 23,684
  2. Avatar for Go Science 2. Go Science 70 pts. 23,665
  3. Avatar for Contenders 3. Contenders 47 pts. 23,598
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,546
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 23,531
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 23,478
  7. Avatar for Australia 7. Australia 7 pts. 23,463
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 23,448
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 23,220
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 23,194
  1. Avatar for gmn 11. gmn Lv 1 49 pts. 23,574
  2. Avatar for fpc 12. fpc Lv 1 45 pts. 23,546
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 42 pts. 23,532
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 39 pts. 23,531
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 36 pts. 23,524
  6. Avatar for hansvandenhof 16. hansvandenhof Lv 1 33 pts. 23,516
  7. Avatar for Steven Pletsch 17. Steven Pletsch Lv 1 30 pts. 23,515
  8. Avatar for ichwilldiesennamen 18. ichwilldiesennamen Lv 1 28 pts. 23,505
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 25 pts. 23,491
  10. Avatar for jausmh 20. jausmh Lv 1 23 pts. 23,488

Comments