Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 23,684
  2. Avatar for Go Science 2. Go Science 70 pts. 23,665
  3. Avatar for Contenders 3. Contenders 47 pts. 23,598
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,546
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 23,531
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 23,478
  7. Avatar for Australia 7. Australia 7 pts. 23,463
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 23,448
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 23,220
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 23,194
  1. Avatar for SemperRabbit 51. SemperRabbit Lv 1 1 pt. 22,562
  2. Avatar for AlphaFold2 52. AlphaFold2 Lv 1 1 pt. 22,509
  3. Avatar for koolcoder101 53. koolcoder101 Lv 1 1 pt. 22,409
  4. Avatar for Dr.Sillem 54. Dr.Sillem Lv 1 1 pt. 22,398
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 22,343
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 22,341
  7. Avatar for dizzywings 57. dizzywings Lv 1 1 pt. 22,307
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 22,301
  9. Avatar for Mohoernchen 59. Mohoernchen Lv 1 1 pt. 22,288
  10. Avatar for Larini 60. Larini Lv 1 1 pt. 22,252

Comments