Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups

  1. Avatar for FamilyBarmettler 11. FamilyBarmettler 1 pt. 17,390
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 17,343
  3. Avatar for Belgium 13. Belgium 1 pt. 17,150
  1. Avatar for gmn 31. gmn Lv 1 6 pts. 17,405
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 6 pts. 17,393
  3. Avatar for WBarme1234 33. WBarme1234 Lv 1 5 pts. 17,390
  4. Avatar for alcor29 34. alcor29 Lv 1 4 pts. 17,352
  5. Avatar for Alistair69 35. Alistair69 Lv 1 4 pts. 17,351
  6. Avatar for Artoria2e5 36. Artoria2e5 Lv 1 3 pts. 17,347
  7. Avatar for Larini 37. Larini Lv 1 3 pts. 17,346
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 3 pts. 17,343
  9. Avatar for SemperRabbit 39. SemperRabbit Lv 1 2 pts. 17,333
  10. Avatar for manu8170 40. manu8170 Lv 1 2 pts. 17,327

Comments