Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 17,548
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 17,546
  3. Avatar for Contenders 3. Contenders 41 pts. 17,539
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 17,526
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 17,505
  6. Avatar for Australia 6. Australia 7 pts. 17,498
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 17,488
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 17,460
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,393
  10. Avatar for VeFold 10. VeFold 1 pt. 17,393
  1. Avatar for gmn 31. gmn Lv 1 6 pts. 17,405
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 6 pts. 17,393
  3. Avatar for WBarme1234 33. WBarme1234 Lv 1 5 pts. 17,390
  4. Avatar for alcor29 34. alcor29 Lv 1 4 pts. 17,352
  5. Avatar for Alistair69 35. Alistair69 Lv 1 4 pts. 17,351
  6. Avatar for Artoria2e5 36. Artoria2e5 Lv 1 3 pts. 17,347
  7. Avatar for Larini 37. Larini Lv 1 3 pts. 17,346
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 3 pts. 17,343
  9. Avatar for SemperRabbit 39. SemperRabbit Lv 1 2 pts. 17,333
  10. Avatar for manu8170 40. manu8170 Lv 1 2 pts. 17,327

Comments