Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups


  1. Avatar for Go Science 100 pts. 17,548
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 17,546
  3. Avatar for Contenders 3. Contenders 41 pts. 17,539
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 17,526
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 17,505
  6. Avatar for Australia 6. Australia 7 pts. 17,498
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 17,488
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 17,460
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,393
  10. Avatar for VeFold 10. VeFold 1 pt. 17,393

  1. Avatar for hansvandenhof 21. hansvandenhof Lv 1 19 pts. 17,490
  2. Avatar for Joanna_H 22. Joanna_H Lv 1 17 pts. 17,488
  3. Avatar for jausmh 23. jausmh Lv 1 15 pts. 17,480
  4. Avatar for Steven Pletsch 24. Steven Pletsch Lv 1 14 pts. 17,477
  5. Avatar for MirsadaH 25. MirsadaH Lv 1 12 pts. 17,460
  6. Avatar for akaaka 26. akaaka Lv 1 11 pts. 17,453
  7. Avatar for Bletchley Park 27. Bletchley Park Lv 1 10 pts. 17,437
  8. Avatar for guineapig 28. guineapig Lv 1 9 pts. 17,427
  9. Avatar for drjr 29. drjr Lv 1 8 pts. 17,412
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 7 pts. 17,411

Comments