Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 17,548
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 17,546
  3. Avatar for Contenders 3. Contenders 41 pts. 17,539
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 17,526
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 17,505
  6. Avatar for Australia 6. Australia 7 pts. 17,498
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 17,488
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 17,460
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,393
  10. Avatar for VeFold 10. VeFold 1 pt. 17,393
  1. Avatar for PrimeLemur 51. PrimeLemur Lv 1 1 pt. 17,160
  2. Avatar for Deleted player 52. Deleted player 1 pt. 17,150
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 17,138
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 17,096
  5. Avatar for koolcoder101 55. koolcoder101 Lv 1 1 pt. 17,035
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 17,027
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 17,025
  8. Avatar for carxo 58. carxo Lv 1 1 pt. 17,022
  9. Avatar for Mohoernchen 59. Mohoernchen Lv 1 1 pt. 17,020
  10. Avatar for jdmclure 60. jdmclure Lv 1 1 pt. 17,020

Comments