Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703
  1. Avatar for pruneau_44 61. pruneau_44 Lv 1 1 pt. 27,901
  2. Avatar for jeremy_canja 62. jeremy_canja Lv 1 1 pt. 27,822
  3. Avatar for NotJim99 63. NotJim99 Lv 1 1 pt. 27,816
  4. Avatar for muffinconsumer 64. muffinconsumer Lv 1 1 pt. 27,797
  5. Avatar for AlexBg 65. AlexBg Lv 1 1 pt. 27,785
  6. Avatar for Dinosaur 66. Dinosaur Lv 1 1 pt. 27,703
  7. Avatar for Swapper242 67. Swapper242 Lv 1 1 pt. 27,696
  8. Avatar for meycen 68. meycen Lv 1 1 pt. 27,665
  9. Avatar for MJ Biochem 69. MJ Biochem Lv 1 1 pt. 27,452
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 27,419

Comments