Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 29,488
  2. Avatar for Contenders 2. Contenders 70 pts. 29,476
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 29,464
  4. Avatar for Go Science 4. Go Science 30 pts. 29,456
  5. Avatar for Australia 5. Australia 19 pts. 29,312
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 29,298
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 29,262
  8. Avatar for Czech National Team 8. Czech National Team 4 pts. 29,184
  9. Avatar for VeFold 9. VeFold 2 pts. 29,118
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 29,048
  1. Avatar for pruneau_44 61. pruneau_44 Lv 1 1 pt. 27,901
  2. Avatar for jeremy_canja 62. jeremy_canja Lv 1 1 pt. 27,822
  3. Avatar for NotJim99 63. NotJim99 Lv 1 1 pt. 27,816
  4. Avatar for muffinconsumer 64. muffinconsumer Lv 1 1 pt. 27,797
  5. Avatar for AlexBg 65. AlexBg Lv 1 1 pt. 27,785
  6. Avatar for Dinosaur 66. Dinosaur Lv 1 1 pt. 27,703
  7. Avatar for Swapper242 67. Swapper242 Lv 1 1 pt. 27,696
  8. Avatar for meycen 68. meycen Lv 1 1 pt. 27,665
  9. Avatar for MJ Biochem 69. MJ Biochem Lv 1 1 pt. 27,452
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 27,419

Comments