Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 29,488
  2. Avatar for Contenders 2. Contenders 70 pts. 29,476
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 29,464
  4. Avatar for Go Science 4. Go Science 30 pts. 29,456
  5. Avatar for Australia 5. Australia 19 pts. 29,312
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 29,298
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 29,262
  8. Avatar for Czech National Team 8. Czech National Team 4 pts. 29,184
  9. Avatar for VeFold 9. VeFold 2 pts. 29,118
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 29,048
  1. Avatar for Mohoernchen 51. Mohoernchen Lv 1 1 pt. 28,080
  2. Avatar for DScott 52. DScott Lv 1 1 pt. 28,071
  3. Avatar for jdmclure 53. jdmclure Lv 1 1 pt. 28,059
  4. Avatar for evifnoskcaj 54. evifnoskcaj Lv 1 1 pt. 28,046
  5. Avatar for koolcoder101 55. koolcoder101 Lv 1 1 pt. 28,024
  6. Avatar for carxo 56. carxo Lv 1 1 pt. 28,008
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 27,998
  8. Avatar for Pietro 58. Pietro Lv 1 1 pt. 27,989
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 27,989
  10. Avatar for ecali 60. ecali Lv 1 1 pt. 27,977

Comments