Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,800
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,683
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,660
  4. Avatar for Belgium 14. Belgium 1 pt. 8,532
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 7,747
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 49 pts. 9,153
  2. Avatar for gmn 12. gmn Lv 1 45 pts. 9,148
  3. Avatar for MicElephant 13. MicElephant Lv 1 42 pts. 9,139
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 39 pts. 9,139
  5. Avatar for guineapig 15. guineapig Lv 1 36 pts. 9,116
  6. Avatar for AmphotericinB 16. AmphotericinB Lv 1 33 pts. 9,113
  7. Avatar for hansvandenhof 17. hansvandenhof Lv 1 30 pts. 9,112
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 28 pts. 9,111
  9. Avatar for Hillbillie 19. Hillbillie Lv 1 25 pts. 9,103
  10. Avatar for maithra 20. maithra Lv 1 23 pts. 9,101

Comments