Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,800
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,683
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,660
  4. Avatar for Belgium 14. Belgium 1 pt. 8,532
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 7,747
  1. Avatar for Gonegirl 41. Gonegirl Lv 1 3 pts. 8,831
  2. Avatar for rosie4loop 42. rosie4loop Lv 1 2 pts. 8,830
  3. Avatar for jausmh 43. jausmh Lv 1 2 pts. 8,816
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 2 pts. 8,800
  5. Avatar for zbp 45. zbp Lv 1 2 pts. 8,791
  6. Avatar for gdnskye 46. gdnskye Lv 1 1 pt. 8,746
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 8,711
  8. Avatar for DScott 48. DScott Lv 1 1 pt. 8,709
  9. Avatar for vybi 49. vybi Lv 1 1 pt. 8,683
  10. Avatar for dahast.de 50. dahast.de Lv 1 1 pt. 8,660

Comments