Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,800
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,683
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,660
  4. Avatar for Belgium 14. Belgium 1 pt. 8,532

  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 8,647
  2. Avatar for Artoria2e5 52. Artoria2e5 Lv 1 1 pt. 8,639
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 8,626
  4. Avatar for carlitosboy15 54. carlitosboy15 Lv 1 1 pt. 8,617
  5. Avatar for crosenquist99 55. crosenquist99 Lv 1 1 pt. 8,595
  6. Avatar for Alistair69 56. Alistair69 Lv 1 1 pt. 8,584
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 8,570
  8. Avatar for Oransche 58. Oransche Lv 1 1 pt. 8,561
  9. Avatar for Deleted player 59. Deleted player 1 pt. 8,532
  10. Avatar for carxo 60. carxo Lv 1 1 pt. 8,520

Comments