Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,701
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 10,559
  3. Avatar for Go Science 3. Go Science 49 pts. 10,539
  4. Avatar for Contenders 4. Contenders 33 pts. 10,465
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,295
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,263
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,132
  8. Avatar for Australia 8. Australia 5 pts. 10,098
  9. Avatar for VeFold 9. VeFold 3 pts. 10,083
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,009
  1. Avatar for jausmh 21. jausmh Lv 1 31 pts. 10,264
  2. Avatar for g_b 22. g_b Lv 1 29 pts. 10,263
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 27 pts. 10,263
  4. Avatar for silent gene 24. silent gene Lv 1 25 pts. 10,260
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 23 pts. 10,243
  6. Avatar for gdnskye 26. gdnskye Lv 1 22 pts. 10,215
  7. Avatar for Steven Pletsch 27. Steven Pletsch Lv 1 20 pts. 10,175
  8. Avatar for Joanna_H 28. Joanna_H Lv 1 19 pts. 10,132
  9. Avatar for AlkiP0Ps 29. AlkiP0Ps Lv 1 18 pts. 10,098
  10. Avatar for Hillbillie 30. Hillbillie Lv 1 16 pts. 10,083

Comments