Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,701
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 10,559
  3. Avatar for Go Science 3. Go Science 49 pts. 10,539
  4. Avatar for Contenders 4. Contenders 33 pts. 10,465
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,295
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,263
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,132
  8. Avatar for Australia 8. Australia 5 pts. 10,098
  9. Avatar for VeFold 9. VeFold 3 pts. 10,083
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,009
  1. Avatar for AmphotericinB 31. AmphotericinB Lv 1 15 pts. 10,047
  2. Avatar for alcor29 32. alcor29 Lv 1 14 pts. 10,022
  3. Avatar for georg137 33. georg137 Lv 1 13 pts. 10,019
  4. Avatar for MirsadaH 34. MirsadaH Lv 1 12 pts. 10,009
  5. Avatar for phi16 35. phi16 Lv 1 11 pts. 9,993
  6. Avatar for roarshock 36. roarshock Lv 1 10 pts. 9,947
  7. Avatar for Larini 37. Larini Lv 1 9 pts. 9,935
  8. Avatar for dizzywings 38. dizzywings Lv 1 9 pts. 9,890
  9. Avatar for vybi 39. vybi Lv 1 8 pts. 9,884
  10. Avatar for rosie4loop 40. rosie4loop Lv 1 7 pts. 9,873

Comments