Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,701
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 10,559
  3. Avatar for Go Science 3. Go Science 49 pts. 10,539
  4. Avatar for Contenders 4. Contenders 33 pts. 10,465
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,295
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,263
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,132
  8. Avatar for Australia 8. Australia 5 pts. 10,098
  9. Avatar for VeFold 9. VeFold 3 pts. 10,083
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,009
  1. Avatar for Trajan464 51. Trajan464 Lv 1 3 pts. 9,579
  2. Avatar for RichGuilmain 52. RichGuilmain Lv 1 3 pts. 9,579
  3. Avatar for carxo 53. carxo Lv 1 2 pts. 9,559
  4. Avatar for AlexBg 54. AlexBg Lv 1 2 pts. 9,546
  5. Avatar for zbp 55. zbp Lv 1 2 pts. 9,495
  6. Avatar for Opelgang 56. Opelgang Lv 1 2 pts. 9,483
  7. Avatar for Simek 57. Simek Lv 1 2 pts. 9,436
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 1 pt. 9,434
  9. Avatar for abiogenesis 59. abiogenesis Lv 1 1 pt. 9,399
  10. Avatar for mengzach 60. mengzach Lv 1 1 pt. 9,327

Comments