Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,701
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 10,559
  3. Avatar for Go Science 3. Go Science 49 pts. 10,539
  4. Avatar for Contenders 4. Contenders 33 pts. 10,465
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,295
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,263
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,132
  8. Avatar for Australia 8. Australia 5 pts. 10,098
  9. Avatar for VeFold 9. VeFold 3 pts. 10,083
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,009
  1. Avatar for Benoll 81. Benoll Lv 1 1 pt. 8,620
  2. Avatar for mart0258 82. mart0258 Lv 1 1 pt. 8,600
  3. Avatar for beanserick 83. beanserick Lv 1 1 pt. 8,595
  4. Avatar for GlassBricks 84. GlassBricks Lv 1 1 pt. 8,567
  5. Avatar for lnmllmnl 85. lnmllmnl Lv 1 1 pt. 8,531
  6. Avatar for Farsheed 86. Farsheed Lv 1 1 pt. 8,509
  7. Avatar for balgarot 87. balgarot Lv 1 1 pt. 8,424
  8. Avatar for pruneau_44 88. pruneau_44 Lv 1 1 pt. 8,414
  9. Avatar for Swapper242 89. Swapper242 Lv 1 1 pt. 8,368
  10. Avatar for salireza111 90. salireza111 Lv 1 1 pt. 8,359

Comments