Icon representing a puzzle

2364: Revisiting Puzzle 110: Turkey

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,701
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 10,559
  3. Avatar for Go Science 3. Go Science 49 pts. 10,539
  4. Avatar for Contenders 4. Contenders 33 pts. 10,465
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,295
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,263
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,132
  8. Avatar for Australia 8. Australia 5 pts. 10,098
  9. Avatar for VeFold 9. VeFold 3 pts. 10,083
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,009
  1. Avatar for koolcoder101 71. koolcoder101 Lv 1 1 pt. 8,917
  2. Avatar for jdmclure 72. jdmclure Lv 1 1 pt. 8,883
  3. Avatar for Merf 73. Merf Lv 1 1 pt. 8,814
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 8,802
  5. Avatar for Marcos Jr. 75. Marcos Jr. Lv 1 1 pt. 8,766
  6. Avatar for aeroplanezz 76. aeroplanezz Lv 1 1 pt. 8,751
  7. Avatar for larsohara 77. larsohara Lv 1 1 pt. 8,671
  8. Avatar for nelsongabriel 78. nelsongabriel Lv 1 1 pt. 8,648
  9. Avatar for B. A. Beder 79. B. A. Beder Lv 1 1 pt. 8,630
  10. Avatar for hansting 80. hansting Lv 1 1 pt. 8,623

Comments