Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups


  1. Avatar for Belgium 11. Belgium 1 pt. 26,868
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 26,688
  3. Avatar for 202302 13. 202302 1 pt. 26,445
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 26,380

  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 7 pts. 27,023
  2. Avatar for roarshock 32. roarshock Lv 1 6 pts. 27,006
  3. Avatar for Larini 33. Larini Lv 1 5 pts. 27,004
  4. Avatar for rosie4loop 34. rosie4loop Lv 1 5 pts. 26,997
  5. Avatar for Gonegirl 35. Gonegirl Lv 1 4 pts. 26,986
  6. Avatar for equilibria 36. equilibria Lv 1 4 pts. 26,955
  7. Avatar for zbp 37. zbp Lv 1 3 pts. 26,933
  8. Avatar for ecali 38. ecali Lv 1 3 pts. 26,911
  9. Avatar for drumpeter18yrs9yrs 39. drumpeter18yrs9yrs Lv 1 2 pts. 26,902
  10. Avatar for Oransche 40. Oransche Lv 1 2 pts. 26,896

Comments