Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 27,182
  2. Avatar for Go Science 2. Go Science 68 pts. 27,177
  3. Avatar for Contenders 3. Contenders 44 pts. 27,150
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 27,130
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 27,108
  6. Avatar for Australia 6. Australia 9 pts. 27,101
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 27,063
  8. Avatar for VeFold 8. VeFold 3 pts. 27,028
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 27,023
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 26,879
  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 7 pts. 27,023
  2. Avatar for roarshock 32. roarshock Lv 1 6 pts. 27,006
  3. Avatar for Larini 33. Larini Lv 1 5 pts. 27,004
  4. Avatar for rosie4loop 34. rosie4loop Lv 1 5 pts. 26,997
  5. Avatar for Gonegirl 35. Gonegirl Lv 1 4 pts. 26,986
  6. Avatar for equilibria 36. equilibria Lv 1 4 pts. 26,955
  7. Avatar for zbp 37. zbp Lv 1 3 pts. 26,933
  8. Avatar for ecali 38. ecali Lv 1 3 pts. 26,911
  9. Avatar for drumpeter18yrs9yrs 39. drumpeter18yrs9yrs Lv 1 2 pts. 26,902
  10. Avatar for Oransche 40. Oransche Lv 1 2 pts. 26,896

Comments