Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 27,182
  2. Avatar for Go Science 2. Go Science 68 pts. 27,177
  3. Avatar for Contenders 3. Contenders 44 pts. 27,150
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 27,130
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 27,108
  6. Avatar for Australia 6. Australia 9 pts. 27,101
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 27,063
  8. Avatar for VeFold 8. VeFold 3 pts. 27,028
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 27,023
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 26,879
  1. Avatar for Merf 51. Merf Lv 1 1 pt. 26,641
  2. Avatar for DScott 52. DScott Lv 1 1 pt. 26,590
  3. Avatar for Arne Heessels 53. Arne Heessels Lv 1 1 pt. 26,589
  4. Avatar for JackONeill12 54. JackONeill12 Lv 1 1 pt. 26,581
  5. Avatar for Dr.Sillem 55. Dr.Sillem Lv 1 1 pt. 26,545
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 26,504
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 26,503
  8. Avatar for Th1sN@me!sN0tAPun 58. Th1sN@me!sN0tAPun Lv 1 1 pt. 26,502
  9. Avatar for Alistair69 59. Alistair69 Lv 1 1 pt. 26,488
  10. Avatar for Ryu Aerim 60. Ryu Aerim Lv 1 1 pt. 26,483

Comments