Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 27,182
  2. Avatar for Go Science 2. Go Science 68 pts. 27,177
  3. Avatar for Contenders 3. Contenders 44 pts. 27,150
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 27,130
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 27,108
  6. Avatar for Australia 6. Australia 9 pts. 27,101
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 27,063
  8. Avatar for VeFold 8. VeFold 3 pts. 27,028
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 27,023
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 26,879
  1. Avatar for Helisaf 61. Helisaf Lv 1 1 pt. 26,475
  2. Avatar for Yechan Kwon 62. Yechan Kwon Lv 1 1 pt. 26,465
  3. Avatar for Menace0528 63. Menace0528 Lv 1 1 pt. 26,460
  4. Avatar for pruneau_44 64. pruneau_44 Lv 1 1 pt. 26,458
  5. Avatar for carxo 65. carxo Lv 1 1 pt. 26,451
  6. Avatar for dy9110 66. dy9110 Lv 1 1 pt. 26,445
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 26,399
  8. Avatar for 122010101049 68. 122010101049 Lv 1 1 pt. 26,380
  9. Avatar for Gematron 2874 69. Gematron 2874 Lv 1 1 pt. 25,902
  10. Avatar for i like sience 70. i like sience Lv 1 1 pt. 22,982

Comments