Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,327
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,256
  3. Avatar for Contenders 3. Contenders 44 pts. 11,255
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 11,115
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,053
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,965
  7. Avatar for Australia 7. Australia 5 pts. 10,954
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 10,926
  9. Avatar for VeFold 9. VeFold 1 pt. 10,655
  10. Avatar for Ukraine 10. Ukraine 1 pt. 10,425

  1. Avatar for AlkiP0Ps 21. AlkiP0Ps Lv 1 26 pts. 10,954
  2. Avatar for fpc 22. fpc Lv 1 24 pts. 10,926
  3. Avatar for MicElephant 23. MicElephant Lv 1 22 pts. 10,888
  4. Avatar for georg137 24. georg137 Lv 1 21 pts. 10,795
  5. Avatar for jausmh 25. jausmh Lv 1 19 pts. 10,752
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 18 pts. 10,737
  7. Avatar for silent gene 27. silent gene Lv 1 16 pts. 10,728
  8. Avatar for roarshock 28. roarshock Lv 1 15 pts. 10,711
  9. Avatar for Opelgang 29. Opelgang Lv 1 14 pts. 10,678
  10. Avatar for Hillbillie 30. Hillbillie Lv 1 13 pts. 10,655

Comments