Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for froschi2 91. froschi2 Lv 1 1 pt. 8,372
  2. Avatar for furi0us 92. furi0us Lv 1 1 pt. 8,334
  3. Avatar for z_0903 93. z_0903 Lv 1 1 pt. 7,864
  4. Avatar for jmv4 94. jmv4 Lv 1 1 pt. 6,862
  5. Avatar for christinaceg 95. christinaceg Lv 1 1 pt. 4,127
  6. Avatar for tophatbromp 96. tophatbromp Lv 1 1 pt. 1,809
  7. Avatar for Yusil 97. Yusil Lv 1 1 pt. 1,289
  8. Avatar for spvincent 98. spvincent Lv 1 1 pt. 1,289
  9. Avatar for Joshuanadzo3 99. Joshuanadzo3 Lv 1 1 pt. 1,289

Comments