Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,791
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,788
  3. Avatar for Contenders 3. Contenders 49 pts. 9,764
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,739
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 9,730
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,712
  7. Avatar for Australia 7. Australia 8 pts. 9,686
  8. Avatar for VeFold 8. VeFold 5 pts. 9,656
  9. Avatar for Ukraine 9. Ukraine 3 pts. 9,635
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 9,612
  1. Avatar for froschi2 91. froschi2 Lv 1 1 pt. 8,372
  2. Avatar for furi0us 92. furi0us Lv 1 1 pt. 8,334
  3. Avatar for z_0903 93. z_0903 Lv 1 1 pt. 7,864
  4. Avatar for jmv4 94. jmv4 Lv 1 1 pt. 6,862
  5. Avatar for christinaceg 95. christinaceg Lv 1 1 pt. 4,127
  6. Avatar for tophatbromp 96. tophatbromp Lv 1 1 pt. 1,809
  7. Avatar for Yusil 97. Yusil Lv 1 1 pt. 1,289
  8. Avatar for spvincent 98. spvincent Lv 1 1 pt. 1,289
  9. Avatar for Joshuanadzo3 99. Joshuanadzo3 Lv 1 1 pt. 1,289

Comments