Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 59 pts. 9,758
  2. Avatar for MicElephant 12. MicElephant Lv 1 56 pts. 9,755
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 53 pts. 9,755
  4. Avatar for AmphotericinB 14. AmphotericinB Lv 1 50 pts. 9,745
  5. Avatar for g_b 15. g_b Lv 1 47 pts. 9,742
  6. Avatar for fpc 16. fpc Lv 1 44 pts. 9,739
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 42 pts. 9,736
  8. Avatar for ecali 18. ecali Lv 1 39 pts. 9,730
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 37 pts. 9,730
  10. Avatar for gmn 20. gmn Lv 1 35 pts. 9,728

Comments