Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 9,791
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,788
  3. Avatar for Contenders 3. Contenders 49 pts. 9,764
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,739
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 9,730
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,712
  7. Avatar for Australia 7. Australia 8 pts. 9,686
  8. Avatar for VeFold 8. VeFold 5 pts. 9,656
  9. Avatar for Ukraine 9. Ukraine 3 pts. 9,635
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 9,612

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 59 pts. 9,758
  2. Avatar for MicElephant 12. MicElephant Lv 1 56 pts. 9,755
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 53 pts. 9,755
  4. Avatar for AmphotericinB 14. AmphotericinB Lv 1 50 pts. 9,745
  5. Avatar for g_b 15. g_b Lv 1 47 pts. 9,742
  6. Avatar for fpc 16. fpc Lv 1 44 pts. 9,739
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 42 pts. 9,736
  8. Avatar for ecali 18. ecali Lv 1 39 pts. 9,730
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 37 pts. 9,730
  10. Avatar for gmn 20. gmn Lv 1 35 pts. 9,728

Comments