Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for Larini 31. Larini Lv 1 17 pts. 9,639
  2. Avatar for RichGuilmain 32. RichGuilmain Lv 1 15 pts. 9,636
  3. Avatar for Commaster 33. Commaster Lv 1 14 pts. 9,635
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 13 pts. 9,612
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 12 pts. 9,607
  6. Avatar for Opelgang 36. Opelgang Lv 1 11 pts. 9,602
  7. Avatar for maithra 37. maithra Lv 1 11 pts. 9,599
  8. Avatar for Antibrad 38. Antibrad Lv 1 10 pts. 9,582
  9. Avatar for vybi 39. vybi Lv 1 9 pts. 9,581
  10. Avatar for alcor29 40. alcor29 Lv 1 8 pts. 9,571

Comments