Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,791
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,788
  3. Avatar for Contenders 3. Contenders 49 pts. 9,764
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,739
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 9,730
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,712
  7. Avatar for Australia 7. Australia 8 pts. 9,686
  8. Avatar for VeFold 8. VeFold 5 pts. 9,656
  9. Avatar for Ukraine 9. Ukraine 3 pts. 9,635
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 9,612
  1. Avatar for Larini 31. Larini Lv 1 17 pts. 9,639
  2. Avatar for RichGuilmain 32. RichGuilmain Lv 1 15 pts. 9,636
  3. Avatar for Commaster 33. Commaster Lv 1 14 pts. 9,635
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 13 pts. 9,612
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 12 pts. 9,607
  6. Avatar for Opelgang 36. Opelgang Lv 1 11 pts. 9,602
  7. Avatar for maithra 37. maithra Lv 1 11 pts. 9,599
  8. Avatar for Antibrad 38. Antibrad Lv 1 10 pts. 9,582
  9. Avatar for vybi 39. vybi Lv 1 9 pts. 9,581
  10. Avatar for alcor29 40. alcor29 Lv 1 8 pts. 9,571

Comments