Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for pfirth 71. pfirth Lv 1 1 pt. 9,020
  2. Avatar for Mohoernchen 72. Mohoernchen Lv 1 1 pt. 8,989
  3. Avatar for B. A. Beder 73. B. A. Beder Lv 1 1 pt. 8,979
  4. Avatar for Yechan Kwon 74. Yechan Kwon Lv 1 1 pt. 8,978
  5. Avatar for rinze 75. rinze Lv 1 1 pt. 8,937
  6. Avatar for ProteinGujo 76. ProteinGujo Lv 1 1 pt. 8,936
  7. Avatar for notgenious 77. notgenious Lv 1 1 pt. 8,904
  8. Avatar for pruneau_44 78. pruneau_44 Lv 1 1 pt. 8,902
  9. Avatar for KWLEE 79. KWLEE Lv 1 1 pt. 8,872
  10. Avatar for jdmclure 80. jdmclure Lv 1 1 pt. 8,841

Comments