Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,791
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,788
  3. Avatar for Contenders 3. Contenders 49 pts. 9,764
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,739
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 9,730
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,712
  7. Avatar for Australia 7. Australia 8 pts. 9,686
  8. Avatar for VeFold 8. VeFold 5 pts. 9,656
  9. Avatar for Ukraine 9. Ukraine 3 pts. 9,635
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 9,612
  1. Avatar for pfirth 71. pfirth Lv 1 1 pt. 9,020
  2. Avatar for Mohoernchen 72. Mohoernchen Lv 1 1 pt. 8,989
  3. Avatar for B. A. Beder 73. B. A. Beder Lv 1 1 pt. 8,979
  4. Avatar for Yechan Kwon 74. Yechan Kwon Lv 1 1 pt. 8,978
  5. Avatar for rinze 75. rinze Lv 1 1 pt. 8,937
  6. Avatar for ProteinGujo 76. ProteinGujo Lv 1 1 pt. 8,936
  7. Avatar for notgenious 77. notgenious Lv 1 1 pt. 8,904
  8. Avatar for pruneau_44 78. pruneau_44 Lv 1 1 pt. 8,902
  9. Avatar for KWLEE 79. KWLEE Lv 1 1 pt. 8,872
  10. Avatar for jdmclure 80. jdmclure Lv 1 1 pt. 8,841

Comments