Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for osc 81. osc Lv 1 1 pt. 8,800
  2. Avatar for DipsyDoodle2016 82. DipsyDoodle2016 Lv 1 1 pt. 8,795
  3. Avatar for ckyamamo 83. ckyamamo Lv 1 1 pt. 8,774
  4. Avatar for Mineral 84. Mineral Lv 1 1 pt. 8,738
  5. Avatar for Hyeok-jae MUN 85. Hyeok-jae MUN Lv 1 1 pt. 8,669
  6. Avatar for Cavalier 86. Cavalier Lv 1 1 pt. 8,543
  7. Avatar for Eunhye 87. Eunhye Lv 1 1 pt. 8,507
  8. Avatar for Meningitidih 88. Meningitidih Lv 1 1 pt. 8,506
  9. Avatar for Helaniuri 89. Helaniuri Lv 1 1 pt. 8,425
  10. Avatar for Ryu Aerim 90. Ryu Aerim Lv 1 1 pt. 8,398

Comments