Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,791
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,788
  3. Avatar for Contenders 3. Contenders 49 pts. 9,764
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,739
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 9,730
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,712
  7. Avatar for Australia 7. Australia 8 pts. 9,686
  8. Avatar for VeFold 8. VeFold 5 pts. 9,656
  9. Avatar for Ukraine 9. Ukraine 3 pts. 9,635
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 9,612
  1. Avatar for osc 81. osc Lv 1 1 pt. 8,800
  2. Avatar for DipsyDoodle2016 82. DipsyDoodle2016 Lv 1 1 pt. 8,795
  3. Avatar for ckyamamo 83. ckyamamo Lv 1 1 pt. 8,774
  4. Avatar for Mineral 84. Mineral Lv 1 1 pt. 8,738
  5. Avatar for Hyeok-jae MUN 85. Hyeok-jae MUN Lv 1 1 pt. 8,669
  6. Avatar for Cavalier 86. Cavalier Lv 1 1 pt. 8,543
  7. Avatar for Eunhye 87. Eunhye Lv 1 1 pt. 8,507
  8. Avatar for Meningitidih 88. Meningitidih Lv 1 1 pt. 8,506
  9. Avatar for Helaniuri 89. Helaniuri Lv 1 1 pt. 8,425
  10. Avatar for Ryu Aerim 90. Ryu Aerim Lv 1 1 pt. 8,398

Comments