Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,470
  2. Avatar for 202302 12. 202302 1 pt. 10,055
  3. Avatar for Team China 13. Team China 1 pt. 9,871
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,626
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,341
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 8,165
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 57 pts. 10,841
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 54 pts. 10,835
  3. Avatar for Joanna_H 13. Joanna_H Lv 1 51 pts. 10,834
  4. Avatar for fpc 14. fpc Lv 1 48 pts. 10,829
  5. Avatar for MicElephant 15. MicElephant Lv 1 45 pts. 10,805
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 42 pts. 10,790
  7. Avatar for Punzi Baker 3 17. Punzi Baker 3 Lv 1 40 pts. 10,786
  8. Avatar for BackBuffer 18. BackBuffer Lv 1 37 pts. 10,780
  9. Avatar for g_b 19. g_b Lv 1 35 pts. 10,748
  10. Avatar for guineapig 20. guineapig Lv 1 33 pts. 10,740

Comments