Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,071
  2. Avatar for Go Science 2. Go Science 71 pts. 11,053
  3. Avatar for Contenders 3. Contenders 49 pts. 10,835
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,834
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,829
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,683
  7. Avatar for Cancer Blasters! 7. Cancer Blasters! 8 pts. 10,648
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,635
  9. Avatar for Australia 9. Australia 3 pts. 10,628
  10. Avatar for VeFold 10. VeFold 2 pts. 10,581
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 57 pts. 10,841
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 54 pts. 10,835
  3. Avatar for Joanna_H 13. Joanna_H Lv 1 51 pts. 10,834
  4. Avatar for fpc 14. fpc Lv 1 48 pts. 10,829
  5. Avatar for MicElephant 15. MicElephant Lv 1 45 pts. 10,805
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 42 pts. 10,790
  7. Avatar for Punzi Baker 3 17. Punzi Baker 3 Lv 1 40 pts. 10,786
  8. Avatar for BackBuffer 18. BackBuffer Lv 1 37 pts. 10,780
  9. Avatar for g_b 19. g_b Lv 1 35 pts. 10,748
  10. Avatar for guineapig 20. guineapig Lv 1 33 pts. 10,740

Comments