Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,470
  2. Avatar for 202302 12. 202302 1 pt. 10,055
  3. Avatar for Team China 13. Team China 1 pt. 9,871
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,626
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,341
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 8,165
  1. Avatar for dy9110 51. dy9110 Lv 1 3 pts. 10,055
  2. Avatar for Trajan464 52. Trajan464 Lv 1 3 pts. 10,021
  3. Avatar for Mineral 53. Mineral Lv 1 2 pts. 9,993
  4. Avatar for pfirth 54. pfirth Lv 1 2 pts. 9,963
  5. Avatar for haleyg 55. haleyg Lv 1 2 pts. 9,958
  6. Avatar for Yusil 56. Yusil Lv 1 2 pts. 9,956
  7. Avatar for pizpot 57. pizpot Lv 1 2 pts. 9,955
  8. Avatar for kitsoune 58. kitsoune Lv 1 1 pt. 9,950
  9. Avatar for Arne Heessels 59. Arne Heessels Lv 1 1 pt. 9,905
  10. Avatar for drumpeter18yrs9yrs 60. drumpeter18yrs9yrs Lv 1 1 pt. 9,894

Comments