Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,071
  2. Avatar for Go Science 2. Go Science 71 pts. 11,053
  3. Avatar for Contenders 3. Contenders 49 pts. 10,835
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,834
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,829
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,683
  7. Avatar for Cancer Blasters! 7. Cancer Blasters! 8 pts. 10,648
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,635
  9. Avatar for Australia 9. Australia 3 pts. 10,628
  10. Avatar for VeFold 10. VeFold 2 pts. 10,581

  1. Avatar for dy9110 51. dy9110 Lv 1 3 pts. 10,055
  2. Avatar for Trajan464 52. Trajan464 Lv 1 3 pts. 10,021
  3. Avatar for Mineral 53. Mineral Lv 1 2 pts. 9,993
  4. Avatar for pfirth 54. pfirth Lv 1 2 pts. 9,963
  5. Avatar for haleyg 55. haleyg Lv 1 2 pts. 9,958
  6. Avatar for Yusil 56. Yusil Lv 1 2 pts. 9,956
  7. Avatar for pizpot 57. pizpot Lv 1 2 pts. 9,955
  8. Avatar for kitsoune 58. kitsoune Lv 1 1 pt. 9,950
  9. Avatar for Arne Heessels 59. Arne Heessels Lv 1 1 pt. 9,905

Comments