Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,470
  2. Avatar for 202302 12. 202302 1 pt. 10,055
  3. Avatar for Team China 13. Team China 1 pt. 9,871
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,626
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,341
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 8,165
  1. Avatar for jdmclure 81. jdmclure Lv 1 1 pt. 9,386
  2. Avatar for Yechan Kwon 82. Yechan Kwon Lv 1 1 pt. 9,354
  3. Avatar for jedward8 83. jedward8 Lv 1 1 pt. 9,341
  4. Avatar for Oskar-Meissner 84. Oskar-Meissner Lv 1 1 pt. 9,305
  5. Avatar for furi0us 85. furi0us Lv 1 1 pt. 9,282
  6. Avatar for Hong Juhyeon 86. Hong Juhyeon Lv 1 1 pt. 9,236
  7. Avatar for jpmehta 87. jpmehta Lv 1 1 pt. 9,016
  8. Avatar for AJ-USAL 88. AJ-USAL Lv 1 1 pt. 8,695
  9. Avatar for kurenan 89. kurenan Lv 1 1 pt. 8,570
  10. Avatar for DiscoveryPlaceScience 90. DiscoveryPlaceScience Lv 1 1 pt. 8,230

Comments