Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,071
  2. Avatar for Go Science 2. Go Science 71 pts. 11,053
  3. Avatar for Contenders 3. Contenders 49 pts. 10,835
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,834
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,829
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,683
  7. Avatar for Cancer Blasters! 7. Cancer Blasters! 8 pts. 10,648
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,635
  9. Avatar for Australia 9. Australia 3 pts. 10,628
  10. Avatar for VeFold 10. VeFold 2 pts. 10,581

  1. Avatar for jdmclure 81. jdmclure Lv 1 1 pt. 9,386
  2. Avatar for Yechan Kwon 82. Yechan Kwon Lv 1 1 pt. 9,354
  3. Avatar for jedward8 83. jedward8 Lv 1 1 pt. 9,341
  4. Avatar for Oskar-Meissner 84. Oskar-Meissner Lv 1 1 pt. 9,305
  5. Avatar for furi0us 85. furi0us Lv 1 1 pt. 9,282
  6. Avatar for Hong Juhyeon 86. Hong Juhyeon Lv 1 1 pt. 9,236
  7. Avatar for jpmehta 87. jpmehta Lv 1 1 pt. 9,016
  8. Avatar for AJ-USAL 88. AJ-USAL Lv 1 1 pt. 8,695
  9. Avatar for kurenan 89. kurenan Lv 1 1 pt. 8,570

Comments