Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,978
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,582
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,544
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 9,231
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 8,856
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,344

  1. Avatar for AmphotericinB 41. AmphotericinB Lv 1 4 pts. 9,812
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 4 pts. 9,795
  3. Avatar for heather-1 43. heather-1 Lv 1 3 pts. 9,787
  4. Avatar for pfirth 44. pfirth Lv 1 3 pts. 9,766
  5. Avatar for carsonfb 45. carsonfb Lv 1 3 pts. 9,747
  6. Avatar for SuperEnzyme 46. SuperEnzyme Lv 1 2 pts. 9,723
  7. Avatar for ProfVince 47. ProfVince Lv 1 2 pts. 9,722
  8. Avatar for Vinara 48. Vinara Lv 1 2 pts. 9,717
  9. Avatar for Oransche 49. Oransche Lv 1 2 pts. 9,680
  10. Avatar for zbp 50. zbp Lv 1 2 pts. 9,659

Comments