Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,214
  2. Avatar for Go Science 2. Go Science 71 pts. 10,137
  3. Avatar for Contenders 3. Contenders 49 pts. 10,135
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,130
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,089
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,072
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,020
  9. Avatar for Australia 9. Australia 3 pts. 10,001
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,988
  1. Avatar for AmphotericinB 41. AmphotericinB Lv 1 4 pts. 9,812
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 4 pts. 9,795
  3. Avatar for heather-1 43. heather-1 Lv 1 3 pts. 9,787
  4. Avatar for pfirth 44. pfirth Lv 1 3 pts. 9,766
  5. Avatar for carsonfb 45. carsonfb Lv 1 3 pts. 9,747
  6. Avatar for SuperEnzyme 46. SuperEnzyme Lv 1 2 pts. 9,723
  7. Avatar for ProfVince 47. ProfVince Lv 1 2 pts. 9,722
  8. Avatar for Vinara 48. Vinara Lv 1 2 pts. 9,717
  9. Avatar for Oransche 49. Oransche Lv 1 2 pts. 9,680
  10. Avatar for zbp 50. zbp Lv 1 2 pts. 9,659

Comments