Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,214
  2. Avatar for Go Science 2. Go Science 71 pts. 10,137
  3. Avatar for Contenders 3. Contenders 49 pts. 10,135
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,130
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,089
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,072
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,020
  9. Avatar for Australia 9. Australia 3 pts. 10,001
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,988

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 53 pts. 10,135
  2. Avatar for manu8170 12. manu8170 Lv 1 49 pts. 10,133
  3. Avatar for fpc 13. fpc Lv 1 46 pts. 10,130
  4. Avatar for ichwilldiesennamen 14. ichwilldiesennamen Lv 1 43 pts. 10,125
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 40 pts. 10,123
  6. Avatar for g_b 16. g_b Lv 1 37 pts. 10,117
  7. Avatar for grogar7 17. grogar7 Lv 1 34 pts. 10,116
  8. Avatar for guineapig 18. guineapig Lv 1 32 pts. 10,115
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 29 pts. 10,109
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 27 pts. 10,104

Comments