Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,214
  2. Avatar for Go Science 2. Go Science 71 pts. 10,137
  3. Avatar for Contenders 3. Contenders 49 pts. 10,135
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,130
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,089
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,072
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,020
  9. Avatar for Australia 9. Australia 3 pts. 10,001
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,988
  1. Avatar for hexidecimalhack 71. hexidecimalhack Lv 1 1 pt. 9,087
  2. Avatar for jdmclure 72. jdmclure Lv 1 1 pt. 9,065
  3. Avatar for Merf 73. Merf Lv 1 1 pt. 8,982
  4. Avatar for osc 74. osc Lv 1 1 pt. 8,897
  5. Avatar for mttl1mutation 75. mttl1mutation Lv 1 1 pt. 8,875
  6. Avatar for HelpME 76. HelpME Lv 1 1 pt. 8,856
  7. Avatar for Norreland 77. Norreland Lv 1 1 pt. 8,787
  8. Avatar for tkfirst 78. tkfirst Lv 1 1 pt. 8,786
  9. Avatar for Trajan464 79. Trajan464 Lv 1 1 pt. 8,627
  10. Avatar for AlphaFold2 80. AlphaFold2 Lv 1 1 pt. 8,344

Comments