Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Belgium 11. Belgium 1 pt. 47,059
  2. Avatar for Team China 12. Team China 1 pt. 45,670
  3. Avatar for 202302 13. 202302 1 pt. 45,665

  1. Avatar for Hillbillie 31. Hillbillie Lv 1 9 pts. 47,272
  2. Avatar for roarshock 32. roarshock Lv 1 8 pts. 47,235
  3. Avatar for Trajan464 33. Trajan464 Lv 1 7 pts. 47,209
  4. Avatar for ecali 34. ecali Lv 1 7 pts. 47,189
  5. Avatar for zbp 35. zbp Lv 1 6 pts. 47,189
  6. Avatar for Larini 36. Larini Lv 1 5 pts. 47,169
  7. Avatar for mengzach 37. mengzach Lv 1 5 pts. 47,141
  8. Avatar for Deleted player 38. Deleted player 5 pts. 47,059
  9. Avatar for rosie4loop 39. rosie4loop Lv 1 4 pts. 46,973
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 4 pts. 46,963

Comments