Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 36,031
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,951
  3. Avatar for 202302 13. 202302 1 pt. 35,261
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 34,396
  1. Avatar for Galaxie 11. Galaxie Lv 1 52 pts. 37,044
  2. Avatar for akaaka 12. akaaka Lv 1 48 pts. 37,038
  3. Avatar for BackBuffer 13. BackBuffer Lv 1 45 pts. 37,014
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 42 pts. 37,013
  5. Avatar for drjr 15. drjr Lv 1 39 pts. 36,961
  6. Avatar for fpc 16. fpc Lv 1 36 pts. 36,929
  7. Avatar for guineapig 17. guineapig Lv 1 33 pts. 36,924
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 31 pts. 36,915
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 28 pts. 36,903
  10. Avatar for phi16 20. phi16 Lv 1 26 pts. 36,896

Comments