Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 36,031
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,951
  3. Avatar for 202302 13. 202302 1 pt. 35,261
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 34,396
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 24 pts. 36,891
  2. Avatar for ecali 22. ecali Lv 1 22 pts. 36,862
  3. Avatar for maithra 23. maithra Lv 1 21 pts. 36,829
  4. Avatar for AlkiP0Ps 24. AlkiP0Ps Lv 1 19 pts. 36,824
  5. Avatar for spvincent 25. spvincent Lv 1 17 pts. 36,729
  6. Avatar for alcor29 26. alcor29 Lv 1 16 pts. 36,677
  7. Avatar for silent gene 27. silent gene Lv 1 15 pts. 36,624
  8. Avatar for Joanna_H 28. Joanna_H Lv 1 13 pts. 36,620
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 12 pts. 36,590
  10. Avatar for Larini 30. Larini Lv 1 11 pts. 36,504

Comments