Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 36,031
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,951
  3. Avatar for 202302 13. 202302 1 pt. 35,261
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 34,396
  1. Avatar for manu8170 31. manu8170 Lv 1 10 pts. 36,496
  2. Avatar for Aubade01 32. Aubade01 Lv 1 9 pts. 36,486
  3. Avatar for georg137 33. georg137 Lv 1 8 pts. 36,483
  4. Avatar for jausmh 34. jausmh Lv 1 7 pts. 36,480
  5. Avatar for Gonegirl 35. Gonegirl Lv 1 7 pts. 36,436
  6. Avatar for vybi 36. vybi Lv 1 6 pts. 36,396
  7. Avatar for Artoria2e5 37. Artoria2e5 Lv 1 6 pts. 36,376
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 5 pts. 36,335
  9. Avatar for roarshock 39. roarshock Lv 1 4 pts. 36,306
  10. Avatar for rosie4loop 40. rosie4loop Lv 1 4 pts. 36,289

Comments