Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 36,031
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,951
  3. Avatar for 202302 13. 202302 1 pt. 35,261
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 34,396
  1. Avatar for Oransche 41. Oransche Lv 1 4 pts. 36,260
  2. Avatar for Commaster 42. Commaster Lv 1 3 pts. 36,247
  3. Avatar for Deleted player 43. Deleted player pts. 36,177
  4. Avatar for Alistair69 44. Alistair69 Lv 1 3 pts. 36,098
  5. Avatar for zbp 45. zbp Lv 1 3 pts. 36,097
  6. Avatar for Mineral 46. Mineral Lv 1 2 pts. 36,051
  7. Avatar for Trajan464 47. Trajan464 Lv 1 2 pts. 36,034
  8. Avatar for mengzach 48. mengzach Lv 1 2 pts. 36,031
  9. Avatar for RichGuilmain 49. RichGuilmain Lv 1 2 pts. 36,025
  10. Avatar for ProfVince 50. ProfVince Lv 1 2 pts. 35,959

Comments