Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 36,031
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,951
  3. Avatar for 202302 13. 202302 1 pt. 35,261
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 34,396
  1. Avatar for ShadowTactics 51. ShadowTactics Lv 1 1 pt. 35,951
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 1 pt. 35,643
  3. Avatar for carsonfb 53. carsonfb Lv 1 1 pt. 35,519
  4. Avatar for Opelgang 54. Opelgang Lv 1 1 pt. 35,459
  5. Avatar for Hillbillie 55. Hillbillie Lv 1 1 pt. 35,441
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 35,410
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 35,317
  8. Avatar for rinze 58. rinze Lv 1 1 pt. 35,272
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 35,271
  10. Avatar for dy9110 60. dy9110 Lv 1 1 pt. 35,261

Comments