Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 36,031
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,951
  3. Avatar for 202302 13. 202302 1 pt. 35,261
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 34,396
  1. Avatar for Mohoernchen 61. Mohoernchen Lv 1 1 pt. 35,185
  2. Avatar for Vinara 62. Vinara Lv 1 1 pt. 35,179
  3. Avatar for pruneau_44 63. pruneau_44 Lv 1 1 pt. 35,117
  4. Avatar for Dark Vamp 64. Dark Vamp Lv 1 1 pt. 35,111
  5. Avatar for jdmclure 65. jdmclure Lv 1 1 pt. 35,100
  6. Avatar for notgenious 66. notgenious Lv 1 1 pt. 35,064
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 35,064
  8. Avatar for Th1sN@me!sN0tAPun 68. Th1sN@me!sN0tAPun Lv 1 1 pt. 35,056
  9. Avatar for harvardman 69. harvardman Lv 1 1 pt. 35,048
  10. Avatar for Dr.Sillem 70. Dr.Sillem Lv 1 1 pt. 34,992

Comments