Placeholder image of a protein
Icon representing a puzzle

2397: Electron Density Reconstruction 71

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two very short chains in this one.

Sequence
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 12,335
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,031
  3. Avatar for Die Bigbrains 13. Die Bigbrains 1 pt. 7,031

  1. Avatar for NPrincipi 21. NPrincipi Lv 1 15 pts. 12,528
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 14 pts. 12,527
  3. Avatar for guineapig 23. guineapig Lv 1 12 pts. 12,516
  4. Avatar for ecali 24. ecali Lv 1 11 pts. 12,514
  5. Avatar for pizpot 25. pizpot Lv 1 10 pts. 12,493
  6. Avatar for silent gene 26. silent gene Lv 1 8 pts. 12,486
  7. Avatar for equilibria 27. equilibria Lv 1 7 pts. 12,480
  8. Avatar for Larini 28. Larini Lv 1 7 pts. 12,478
  9. Avatar for akaaka 29. akaaka Lv 1 6 pts. 12,476
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 5 pts. 12,474

Comments